SCOP 1.71: Domain d1wpmb_: 1wpm B:

Lineage for d1wpmb_ (1wpm B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 6 strands, order 321456
   Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest

4. Superfamily c.107.1: DHH phosphoesterases [64182] (2 families)
   constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains

5. Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (1 protein)

6. Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [69610] (3 PDB entries)

8. Domain d1wpmb_: 1wpm B: [114825]
   complexed with pg4, so4

Details for d1wpmb_

PDB Entry: 1wpm, 2.05 Å

PDB Description: structure of bacillus subtilis inorganic pyrophosphatase

SCOP Domain Sequences for d1wpmb_:

Sequence; same for both SEQRES and ATOM records:

>d1wpmb_ c.107.1.1 (B:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis}
mekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprl
vetaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgcta
tilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeey
glnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleavisk
vvaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvv
pvltdama

Timeline for d1wpmb_:

• d1wpmb_ is new in SCOP 1.71
  
• d1wpmb_ appears in SCOP 1.73
  
• d1wpmb_ appears in the current release, SCOPe 2.08