SCOPe 2.07: Domain d1wpma_: 1wpm A:

Lineage for d1wpma_ (1wpm A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 6 strands, order 321456
   Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest

4. Superfamily c.107.1: DHH phosphoesterases [64182] (3 families)
   constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains

5. Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (2 proteins)

6. Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [69610] (5 PDB entries)
   Uniprot P37487

8. Domain d1wpma_: 1wpm A: [114824]
   complexed with pg4, so4

Details for d1wpma_

PDB Entry: 1wpm, 2.05 Å

PDB Description: structure of bacillus subtilis inorganic pyrophosphatase

PDB Compounds: (A:) Manganese-dependent inorganic pyrophosphatase

SCOPe Domain Sequences for d1wpma_:

Sequence; same for both SEQRES and ATOM records:

>d1wpma_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]}
ekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprlv
etaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgctat
ilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeeyg
lnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleaviskv
vaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvvp
vltdama

Timeline for d1wpma_:

• d1wpma_ first appeared in SCOP 1.71
  
• d1wpma_ appears in SCOPe 2.06
  
• d1wpma_ appears in the current release, SCOPe 2.08