Lineage for d1wpha_ (1wph A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546038Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 546039Superfamily a.211.1: HD-domain/PDEase-like [109604] (3 families) (S)
  5. 546040Family a.211.1.1: HD domain [101340] (3 proteins)
    Pfam 01966; metal dependent phosphohydrolases
  6. 546041Protein 5'-nucleotidase YfbR [116969] (1 species)
  7. 546042Species Escherichia coli [TaxId:562] [116970] (1 PDB entry)
  8. 546043Domain d1wpha_: 1wph A: [114822]

Details for d1wpha_

PDB Entry: 1wph (more details), 2.1 Å

PDB Description: Structure of APC11001: Hypothetical member of the HD metal-binding phosphohydrolase superfamily

SCOP Domain Sequences for d1wpha_:

Sequence, based on SEQRES records: (download)

>d1wpha_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplid
ehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmei
fvpsfh

Sequence, based on observed residues (ATOM records): (download)

>d1wpha_ a.211.1.1 (A:) 5'-nucleotidase YfbR {Escherichia coli}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpqeykaiekiaqqklvdmvpeelrdifaplidehaysdeek
slvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh

SCOP Domain Coordinates for d1wpha_:

Click to download the PDB-style file with coordinates for d1wpha_.
(The format of our PDB-style files is described here.)

Timeline for d1wpha_:

  • d1wpha_ is new in SCOP 1.71
  • d1wpha_ does not appear in SCOP 1.73

View in 3D
Domains from other chains:
(mouse over for more information)
d1wphb_