Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily) core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains |
Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) |
Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein) |
Protein Calcium ATPase, transmembrane domain M [81663] (1 species) the N-terminal 40 residues interact with /form a part of transduction domain A |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (37 PDB entries) Uniprot P04191 |
Domain d1wpgd4: 1wpg D:1-124,D:240-343,D:751-994 [114821] Other proteins in same PDB: d1wpga1, d1wpga2, d1wpga3, d1wpgb1, d1wpgb2, d1wpgb3, d1wpgc1, d1wpgc2, d1wpgc3, d1wpgd1, d1wpgd2, d1wpgd3 complexed with adp, mf4, mg, na, tg1 |
PDB Entry: 1wpg (more details), 2.3 Å
SCOPe Domain Sequences for d1wpgd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpgd4 f.33.1.1 (D:1-124,D:240-343,D:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg
Timeline for d1wpgd4: