![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432 |
![]() | Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) ![]() |
![]() | Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins) |
![]() | Protein Calcium ATPase [81658] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (40 PDB entries) Uniprot P04191 |
![]() | Domain d1wpgd3: 1wpg D:361-599 [114820] Other proteins in same PDB: d1wpga1, d1wpga2, d1wpga4, d1wpgb1, d1wpgb2, d1wpgb4, d1wpgc1, d1wpgc2, d1wpgc4, d1wpgd1, d1wpgd2, d1wpgd4 complexed with adp, mf4, mg, na, tg1 |
PDB Entry: 1wpg (more details), 2.3 Å
SCOPe Domain Sequences for d1wpgd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpgd3 d.220.1.1 (D:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
Timeline for d1wpgd3: