SCOP 1.73: Domain d1wpea2: 1wpe A:344-360,A:600-750

Lineage for d1wpea2 (1wpe A:344-360,A:600-750)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (2 proteins)
   interrupted by a large insertion, domain N

6. Protein Calcium ATPase, catalytic domain P [81655] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (9 PDB entries)

8. Domain d1wpea2: 1wpe A:344-360,A:600-750 [114803]
   Other proteins in same PDB: d1wpea1, d1wpea3, d1wpea4
   complexed with adp, af3, ca, mg

Details for d1wpea2

PDB Entry: 1wpe, 2.7 Å

PDB Description: crystal structure of the sr calcium pump with bound aluminium fluoride, adp and calcium

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOP Domain Sequences for d1wpea2:

Sequence; same for both SEQRES and ATOM records:

>d1wpea2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

Timeline for d1wpea2:

• d1wpea2 first appeared in SCOP 1.71
  
• d1wpea2 last appears in SCOP 1.75