Lineage for d1wpea1 (1wpe A:125-239)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 678178Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 678179Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 678180Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 678181Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (9 PDB entries)
  8. 678191Domain d1wpea1: 1wpe A:125-239 [114802]
    Other proteins in same PDB: d1wpea2, d1wpea3, d1wpea4
    complexed with adp, af3, ca, mg

Details for d1wpea1

PDB Entry: 1wpe (more details), 2.7 Å

PDB Description: crystal structure of the sr calcium pump with bound aluminium fluoride, adp and calcium
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOP Domain Sequences for d1wpea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpea1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOP Domain Coordinates for d1wpea1:

Click to download the PDB-style file with coordinates for d1wpea1.
(The format of our PDB-style files is described here.)

Timeline for d1wpea1: