SCOP 1.71: Domain d1wpea1: 1wpe A:125-239

Lineage for d1wpea1 (1wpe A:125-239)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family)
   a distorted variant of double-helix

5. Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)

6. Protein Calcium ATPase, transduction domain A [81651] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (9 PDB entries)

8. Domain d1wpea1: 1wpe A:125-239 [114802]
   Other proteins in same PDB: d1wpea2, d1wpea3, d1wpea4
   complexed with adp, af3, ca, mg

Details for d1wpea1

PDB Entry: 1wpe, 2.7 Å

PDB Description: crystal structure of the sr calcium pump with bound aluminium fluoride, adp and calcium

SCOP Domain Sequences for d1wpea1:

Sequence; same for both SEQRES and ATOM records:

>d1wpea1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus)}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

Timeline for d1wpea1:

• d1wpea1 is new in SCOP 1.71
  
• d1wpea1 appears in SCOP 1.73
  
• d1wpea1 last appears in SCOP 1.75