Lineage for d1wpda_ (1wpd A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635336Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 2635413Protein Maurotoxin [57129] (2 species)
  7. 2635416Species Scorpion (Scorpio maurus) [TaxId:53956] [57130] (3 PDB entries)
    Uniprot P80719
  8. 2635419Domain d1wpda_: 1wpd A: [114801]
    chimera with hstx1

Details for d1wpda_

PDB Entry: 1wpd (more details)

PDB Description: evidence for domain-specific recognition of sk and kv channels by mtx and hstx1 scorpion toxins
PDB Compounds: (A:) MTx-HsTx1

SCOPe Domain Sequences for d1wpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpda_ g.3.7.2 (A:) Maurotoxin {Scorpion (Scorpio maurus) [TaxId: 53956]}
vsctgskdcyapcrkqtgcpygkcmnrkckcnrc

SCOPe Domain Coordinates for d1wpda_:

Click to download the PDB-style file with coordinates for d1wpda_.
(The format of our PDB-style files is described here.)

Timeline for d1wpda_: