Lineage for d1wpda_ (1wpd A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030655Protein Maurotoxin [57129] (2 species)
  7. 3030658Species Scorpion (Scorpio maurus) [TaxId:53956] [57130] (3 PDB entries)
    Uniprot P80719
  8. 3030661Domain d1wpda_: 1wpd A: [114801]
    chimera with hstx1

Details for d1wpda_

PDB Entry: 1wpd (more details)

PDB Description: evidence for domain-specific recognition of sk and kv channels by mtx and hstx1 scorpion toxins
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 6.2,Potassium channel toxin alpha-KTx 6.3

SCOPe Domain Sequences for d1wpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpda_ g.3.7.2 (A:) Maurotoxin {Scorpion (Scorpio maurus) [TaxId: 53956]}
vsctgskdcyapcrkqtgcpygkcmnrkckcnrc

SCOPe Domain Coordinates for d1wpda_:

Click to download the PDB-style file with coordinates for d1wpda_.
(The format of our PDB-style files is described here.)

Timeline for d1wpda_: