SCOP 1.73: Domain d1wpca2: 1wpc A:5-398

Lineage for d1wpca2 (1wpc A:5-398)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Bacterial alpha-amylase [51447] (10 species)

7. Species Bacillus sp. 707 [TaxId:1416] [117366] (4 PDB entries)

8. Domain d1wpca2: 1wpc A:5-398 [114800]
   Other proteins in same PDB: d1wpca1
   complexed with aci, ca, glb, glc, gld, na

Details for d1wpca2

PDB Entry: 1wpc, 1.9 Å

PDB Description: crystal structure of maltohexaose-producing amylase complexed with pseudo-maltononaose

PDB Compounds: (A:) Glucan 1,4-alpha-maltohexaosidase

SCOP Domain Sequences for d1wpca2:

Sequence; same for both SEQRES and ATOM records:

>d1wpca2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]}
tngtmmqyfewylpndgnhwnrlnsdasnlkskgitavwippawkgasqndvgygaydly
dlgefnqkgtvrtkygtrsqlqaavtslknngiqvygdvvmnhkggadatemvravevnp
nnrnqevtgeytieawtrfdfpgrgnthssfkwrwyhfdgvdwdqsrrlnnriykfrghg
kawdwevdtengnydylmyadidmdhpevvnelrnwgvwytntlgldgfridavkhikys
ftrdwinhvrsatgknmfavaefwkndlgaienylqktnwnhsvfdvplhynlynasksg
gnydmrnifngtvvqrhpshavtfvdnhdsqpeealesfveewfkplayaltltreqgyp
svfygdyygipthgvpamrskidpilearqkyay

Timeline for d1wpca2:

• d1wpca2 first appeared in SCOP 1.71
  
• d1wpca2 appears in SCOP 1.75
  
• d1wpca2 appears in the current release, SCOPe 2.08