Lineage for d1wpbd_ (1wpb D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754210Fold a.233: YfbU-like [116959] (1 superfamily)
    multihelical; consist of two subdomains; forms 24-mer with the N-terminal sudbomains packing around the 4-fold axis and the C-terminal domains interacting at the 2-fold and 3-fold axes
  4. 1754211Superfamily a.233.1: YfbU-like [116960] (1 family) (S)
    automatically mapped to Pfam PF03887
  5. 1754212Family a.233.1.1: YfbU-like [116961] (2 proteins)
    Pfam PF03887
  6. 1754213Protein Hypothetical protein YfbU [116962] (1 species)
  7. 1754214Species Escherichia coli [TaxId:562] [116963] (1 PDB entry)
    Uniprot P0A8W8
  8. 1754218Domain d1wpbd_: 1wpb D: [114786]
    Structural genomics target
    complexed with cl, gol

Details for d1wpbd_

PDB Entry: 1wpb (more details), 2 Å

PDB Description: Structure of Escherichia coli yfbU gene product
PDB Compounds: (D:) hypothetical protein yfbU

SCOPe Domain Sequences for d1wpbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpbd_ a.233.1.1 (D:) Hypothetical protein YfbU {Escherichia coli [TaxId: 562]}
qestmemtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelke
etcrtiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegr
ythfdagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina

SCOPe Domain Coordinates for d1wpbd_:

Click to download the PDB-style file with coordinates for d1wpbd_.
(The format of our PDB-style files is described here.)

Timeline for d1wpbd_: