SCOP 1.73: Domain d1wp6a1: 1wp6 A:399-485

Lineage for d1wp6a1 (1wp6 A:399-485)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries)

8. Domain d1wp6a1: 1wp6 A:399-485 [114781]
   Other proteins in same PDB: d1wp6a2
   complexed with ca, na, po4, trs

Details for d1wp6a1

PDB Entry: 1wp6, 2.1 Å

PDB Description: Crystal structure of maltohexaose-producing amylase from alkalophilic Bacillus sp.707.

PDB Compounds: (A:) Glucan 1,4-alpha-maltohexaosidase

SCOP Domain Sequences for d1wp6a1:

Sequence; same for both SEQRES and ATOM records:

>d1wp6a1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]}
gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr
tgtvtinadgwgnfsvnggsvsiwvnk

Timeline for d1wp6a1:

• d1wp6a1 first appeared in SCOP 1.71
  
• d1wp6a1 appears in SCOP 1.75
  
• d1wp6a1 appears in the current release, SCOPe 2.08