![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Bacterial alpha-Amylase [51013] (9 species) |
![]() | Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries) Uniprot P19571 38-518 |
![]() | Domain d1wp6a1: 1wp6 A:399-485 [114781] Other proteins in same PDB: d1wp6a2 complexed with ca, na, po4, trs |
PDB Entry: 1wp6 (more details), 2.1 Å
SCOPe Domain Sequences for d1wp6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wp6a1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]} gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr tgtvtinadgwgnfsvnggsvsiwvnk
Timeline for d1wp6a1: