![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.10: GyrA/ParC C-terminal domain-like [101904] (2 families) ![]() beta-pinwheel, a variant of beta-propeller fold; unlike an canonical beta-propeller, strands 1 and 4 of each four-strand repeat unit are in one blade whereas strands 2 and 3 are in the next blade |
![]() | Family b.68.10.1: GyrA/ParC C-terminal domain-like [101905] (2 proteins) Pfam PF03989; functional conformational changes result in breaking the interface between the N- and C-terminal blades |
![]() | Protein Topoisomerase IV subunit A, ParC, C-terminal domain [117279] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [117280] (1 PDB entry) Uniprot Q45066 499-805 # 63% sequence identity; Bacillus subtilis TaxID: 1423 |
![]() | Domain d1wp5a1: 1wp5 A:1-313 [114780] Other proteins in same PDB: d1wp5a2 |
PDB Entry: 1wp5 (more details), 1.79 Å
SCOPe Domain Sequences for d1wp5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wp5a1 b.68.10.1 (A:1-313) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} mvasedvivtvtkdgyvkrtslrsyaasngqdfamkdtdrllamlemntkdvlllftnkg nylycpvhelpdirwkdlgqhianiipidrdeeiikaipindfelngyflfvtrngmvkk telkhykaqryskpltginlknddqvvdvhltdgmnelflvthngyalwfdesevsivgv raagvkgmnlkegdyivsgqlitskdesivvatqrgavkkmkltefekatrakrgvvilr elkanphrisgfvvaqdsdtiylqteksfietikvgdirfsdrysngsfvldeeengrvi svwkveaedktek
Timeline for d1wp5a1: