SCOPe 2.08: Domain d1wp5a1: 1wp5 A:1-313

Lineage for d1wp5a1 (1wp5 A:1-313)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.10: GyrA/ParC C-terminal domain-like [101904] (2 families)
   beta-pinwheel, a variant of beta-propeller fold; unlike an canonical beta-propeller, strands 1 and 4 of each four-strand repeat unit are in one blade whereas strands 2 and 3 are in the next blade

5. Family b.68.10.1: GyrA/ParC C-terminal domain-like [101905] (2 proteins)
   Pfam PF03989; functional conformational changes result in breaking the interface between the N- and C-terminal blades

6. Protein Topoisomerase IV subunit A, ParC, C-terminal domain [117279] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [117280] (1 PDB entry)
   Uniprot Q45066 499-805 # 63% sequence identity; Bacillus subtilis TaxID: 1423

8. Domain d1wp5a1: 1wp5 A:1-313 [114780]
   Other proteins in same PDB: d1wp5a2

Details for d1wp5a1

PDB Entry: 1wp5, 1.79 Å

PDB Description: Crystal structure of the C-terminal domain of DNA topoisomerase IV

PDB Compounds: (A:) topoisomerase IV

SCOPe Domain Sequences for d1wp5a1:

Sequence; same for both SEQRES and ATOM records:

>d1wp5a1 b.68.10.1 (A:1-313) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
mvasedvivtvtkdgyvkrtslrsyaasngqdfamkdtdrllamlemntkdvlllftnkg
nylycpvhelpdirwkdlgqhianiipidrdeeiikaipindfelngyflfvtrngmvkk
telkhykaqryskpltginlknddqvvdvhltdgmnelflvthngyalwfdesevsivgv
raagvkgmnlkegdyivsgqlitskdesivvatqrgavkkmkltefekatrakrgvvilr
elkanphrisgfvvaqdsdtiylqteksfietikvgdirfsdrysngsfvldeeengrvi
svwkveaedktek

Timeline for d1wp5a1:

• d1wp5a1 first appeared in SCOP 1.71, called d1wp5a_
  
• d1wp5a1 appears in SCOPe 2.07