Lineage for d1woac_ (1woa C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681099Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 681100Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 681101Protein Triosephosphate isomerase [51353] (17 species)
  7. 681183Species Plasmodium falciparum [TaxId:5833] [51359] (9 PDB entries)
  8. 681203Domain d1woac_: 1woa C: [114772]

Details for d1woac_

PDB Entry: 1woa (more details), 2.8 Å

PDB Description: structure of the loop6 hinge mutant of plasmodium falciparum triosephosphate isomerase, w168f, complexed with glycerol-2-phosphate
PDB Compounds: (C:) triosephosphate isomerase

SCOP Domain Sequences for d1woac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woac_ c.1.1.1 (C:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]}
rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplfaigtgktatpeqaq
lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
iiksam

SCOP Domain Coordinates for d1woac_:

Click to download the PDB-style file with coordinates for d1woac_.
(The format of our PDB-style files is described here.)

Timeline for d1woac_: