![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) ![]() |
![]() | Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
![]() | Protein Triosephosphate isomerase [51353] (21 species) |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (31 PDB entries) Uniprot Q07412 |
![]() | Domain d1woab_: 1woa B: [114771] complexed with g2h; mutant |
PDB Entry: 1woa (more details), 2.8 Å
SCOPe Domain Sequences for d1woab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1woab_ c.1.1.1 (B:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg iqnvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplfaigtgktatpeqaq lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd iiksam
Timeline for d1woab_: