Lineage for d1wnxa_ (1wnx A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544344Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 544345Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 544346Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 protein domains)
  6. 544347Protein Heme oxygenase HmuO [89159] (1 species)
  7. 544348Species Corynebacterium diphtheriae [TaxId:1717] [89160] (6 PDB entries)
  8. 544355Domain d1wnxa_: 1wnx A: [114768]

Details for d1wnxa_

PDB Entry: 1wnx (more details), 1.85 Å

PDB Description: D136E mutant of Heme Oxygenase from Corynebacterium diphtheriae (HmuO)

SCOP Domain Sequences for d1wnxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnxa_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgelsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

SCOP Domain Coordinates for d1wnxa_:

Click to download the PDB-style file with coordinates for d1wnxa_.
(The format of our PDB-style files is described here.)

Timeline for d1wnxa_: