Lineage for d1wnwc_ (1wnw C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777764Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 777773Protein Heme oxygenase HmuO [89159] (1 species)
  7. 777774Species Corynebacterium diphtheriae [TaxId:1717] [89160] (10 PDB entries)
    Uniprot P71119
  8. 777792Domain d1wnwc_: 1wnw C: [114767]
    complexed with hem, iod, na, so4; mutant

Details for d1wnwc_

PDB Entry: 1wnw (more details), 1.7 Å

PDB Description: D136N mutant of Heme Oxygenase from Corynebacterium diphtheriae (HmuO)
PDB Compounds: (C:) Heme oxygenase

SCOP Domain Sequences for d1wnwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnwc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgnlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlg

SCOP Domain Coordinates for d1wnwc_:

Click to download the PDB-style file with coordinates for d1wnwc_.
(The format of our PDB-style files is described here.)

Timeline for d1wnwc_: