Lineage for d1wnwc_ (1wnw C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011418Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 protein domains)
    automatically mapped to Pfam PF01126
  6. 2011422Protein Heme oxygenase HmuO [89159] (1 species)
  7. 2011423Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
    Uniprot P71119
  8. 2011444Domain d1wnwc_: 1wnw C: [114767]
    complexed with hem, iod, na, so4; mutant

Details for d1wnwc_

PDB Entry: 1wnw (more details), 1.7 Å

PDB Description: D136N mutant of Heme Oxygenase from Corynebacterium diphtheriae (HmuO)
PDB Compounds: (C:) Heme oxygenase

SCOPe Domain Sequences for d1wnwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnwc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgnlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlg

SCOPe Domain Coordinates for d1wnwc_:

Click to download the PDB-style file with coordinates for d1wnwc_.
(The format of our PDB-style files is described here.)

Timeline for d1wnwc_: