Lineage for d1wnva_ (1wnv A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544344Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 544345Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 544346Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 544347Protein Heme oxygenase HmuO [89159] (1 species)
  7. 544348Species Corynebacterium diphtheriae [TaxId:1717] [89160] (6 PDB entries)
  8. 544363Domain d1wnva_: 1wnv A: [114762]

Details for d1wnva_

PDB Entry: 1wnv (more details), 1.85 Å

PDB Description: d136a mutant of heme oxygenase from corynebacterium diphtheriae (hmuo)

SCOP Domain Sequences for d1wnva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnva_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgalsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

SCOP Domain Coordinates for d1wnva_:

Click to download the PDB-style file with coordinates for d1wnva_.
(The format of our PDB-style files is described here.)

Timeline for d1wnva_: