Lineage for d1wnrf_ (1wnr F:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
    Uniprot P61493 ! Uniprot P61492
  8. Domain d1wnrf_: 1wnr F: [114760]

Details for d1wnrf_

PDB Entry: 1wnr (more details), 2.9 Å

PDB Description: Crystal structure of the Cpn10 from Thermus thermophilus HB8
PDB Compounds: (F:) 10 kda chaperonin

SCOPe Domain Sequences for d1wnrf_:

Sequence, based on SEQRES records: (download)

>d1wnrf_ b.35.1.1 (F:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
gdivvfakyggteieidgeeyvilserdllavlq

Sequence, based on observed residues (ATOM records): (download)

>d1wnrf_ b.35.1.1 (F:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
eyvilserdllavlq

SCOPe Domain Coordinates for d1wnrf_ are not available.

Timeline for d1wnrf_:

Domains from other chains:
(mouse over for more information)
d1wnra_, d1wnrb_, d1wnrc_, d1wnrd_, d1wnre_, d1wnrg_