Lineage for d1wnrb_ (1wnr B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2394951Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2394952Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2394953Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 2394954Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 2395046Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
    Uniprot P61493 ! Uniprot P61492
  8. 2395048Domain d1wnrb_: 1wnr B: [114756]

Details for d1wnrb_

PDB Entry: 1wnr (more details), 2.9 Å

PDB Description: Crystal structure of the Cpn10 from Thermus thermophilus HB8
PDB Compounds: (B:) 10 kda chaperonin

SCOPe Domain Sequences for d1wnrb_:

Sequence, based on SEQRES records: (download)

>d1wnrb_ b.35.1.1 (B:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplevke
gdivvfakyggteieidgeeyvilserdllavlq

Sequence, based on observed residues (ATOM records): (download)

>d1wnrb_ b.35.1.1 (B:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
mikplgdrvvvkripqkgkviavgtgrvlengqrvplevkegdivvfakyggteieidge
eyvilserdllavlq

SCOPe Domain Coordinates for d1wnrb_:

Click to download the PDB-style file with coordinates for d1wnrb_.
(The format of our PDB-style files is described here.)

Timeline for d1wnrb_: