SCOPe 2.06: Domain d1wndd_: 1wnd D:

Lineage for d1wndd_ (1wnd D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.1: ALDH-like [53721] (6 proteins)

6. Protein Putative betaine aldehyde dehydrogenase YdcW [117733] (1 species)

7. Species Escherichia coli [TaxId:562] [117734] (2 PDB entries)
   Uniprot P77674

8. Domain d1wndd_: 1wnd D: [114754]
   complexed with ca

Details for d1wndd_

PDB Entry: 1wnd, 2.1 Å

PDB Description: escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase as determined by kinetics and crystal structure

PDB Compounds: (D:) Putative betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d1wndd_:

Sequence; same for both SEQRES and ATOM records:

>d1wndd_ c.82.1.1 (D:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]}
mqhkllingelvsgegekqpvynpatgdvlleiaeasaeqvdaavraadaafaewgqttp
kvraecllkladvieengqvfaelesrncgkplhsafndeipaivdvfrffagaarclng
laageyleghtsmirrdplgvvasiapwnyplmmaawklapalaagncvvlkpseitplt
alklaelakdifpagvvnilfgrgktvgdpltghpkvrmvsltgsiatgehiishtassi
krthmelggkapvivfddadieavvegvrtfgyynagqdctaacriyaqkgiydtlvekl
gaavatlksgapddestelgplsslahlervgkaveeakatghikvitggekrkgngyyy
aptllagalqddaivqkevfgpvvsvtpfdneeqvvnwandsqyglassvwtkdvgrahr
vsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhvmvkh

Timeline for d1wndd_:

• d1wndd_ first appeared in SCOP 1.71
  
• d1wndd_ appears in SCOPe 2.05
  
• d1wndd_ appears in SCOPe 2.07
  
• d1wndd_ appears in the current release, SCOPe 2.08