Lineage for d1wndb_ (1wnd B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2908568Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 2908881Protein Putative betaine aldehyde dehydrogenase YdcW [117733] (1 species)
  7. 2908882Species Escherichia coli [TaxId:562] [117734] (2 PDB entries)
    Uniprot P77674
  8. 2908888Domain d1wndb_: 1wnd B: [114752]
    complexed with ca

Details for d1wndb_

PDB Entry: 1wnd (more details), 2.1 Å

PDB Description: escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase as determined by kinetics and crystal structure
PDB Compounds: (B:) Putative betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d1wndb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wndb_ c.82.1.1 (B:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]}
mqhkllingelvsgegekqpvynpatgdvlleiaeasaeqvdaavraadaafaewgqttp
kvraecllkladvieengqvfaelesrncgkplhsafndeipaivdvfrffagaarclng
laageyleghtsmirrdplgvvasiapwnyplmmaawklapalaagncvvlkpseitplt
alklaelakdifpagvvnilfgrgktvgdpltghpkvrmvsltgsiatgehiishtassi
krthmelggkapvivfddadieavvegvrtfgyynagqdctaacriyaqkgiydtlvekl
gaavatlksgapddestelgplsslahlervgkaveeakatghikvitggekrkgngyyy
aptllagalqddaivqkevfgpvvsvtpfdneeqvvnwandsqyglassvwtkdvgrahr
vsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhvmvkh

SCOPe Domain Coordinates for d1wndb_:

Click to download the PDB-style file with coordinates for d1wndb_.
(The format of our PDB-style files is described here.)

Timeline for d1wndb_: