Lineage for d1wnbc_ (1wnb C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592357Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 592358Superfamily c.82.1: ALDH-like [53720] (2 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 592359Family c.82.1.1: ALDH-like [53721] (5 proteins)
  6. 592524Protein Putative betaine aldehyde dehydrogenase YdcW [117733] (1 species)
  7. 592525Species Escherichia coli [TaxId:562] [117734] (2 PDB entries)
  8. 592532Domain d1wnbc_: 1wnb C: [114749]

Details for d1wnbc_

PDB Entry: 1wnb (more details), 2.2 Å

PDB Description: Escherichia coli YdcW gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde)

SCOP Domain Sequences for d1wnbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnbc_ c.82.1.1 (C:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli}
mqhkllingelvsgegekqpvynpatgdvlleiaeasaeqvdaavraadaafaewgqttp
kvraecllkladvieengqvfaelesrncgkplhsafndeipaivdvfrffagaarclng
laageyleghtsmirrdplgvvasiapwnyplmmaawklapalaagncvvlkpseitplt
alklaelakdifpagvvnilfgrgktvgdpltghpkvrmvsltgsiatgehiishtassi
krthmelggkapvivfddadieavvegvrtfgyynagqdctaacriyaqkgiydtlvekl
gaavatlksgapddestelgplsslahlervgkaveeakatghikvitggekrkgngyyy
aptllagalqddaivqkevfgpvvsvtpfdneeqvvnwandsqyglassvwtkdvgrahr
vsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhvmvkh

SCOP Domain Coordinates for d1wnbc_:

Click to download the PDB-style file with coordinates for d1wnbc_.
(The format of our PDB-style files is described here.)

Timeline for d1wnbc_: