Lineage for d1wnbc_ (1wnb C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2908568Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 2908881Protein Putative betaine aldehyde dehydrogenase YdcW [117733] (1 species)
  7. 2908882Species Escherichia coli [TaxId:562] [117734] (2 PDB entries)
    Uniprot P77674
  8. 2908885Domain d1wnbc_: 1wnb C: [114749]
    complexed with btl, nai

Details for d1wnbc_

PDB Entry: 1wnb (more details), 2.2 Å

PDB Description: Escherichia coli YdcW gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde)
PDB Compounds: (C:) Putative betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d1wnbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnbc_ c.82.1.1 (C:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]}
mqhkllingelvsgegekqpvynpatgdvlleiaeasaeqvdaavraadaafaewgqttp
kvraecllkladvieengqvfaelesrncgkplhsafndeipaivdvfrffagaarclng
laageyleghtsmirrdplgvvasiapwnyplmmaawklapalaagncvvlkpseitplt
alklaelakdifpagvvnilfgrgktvgdpltghpkvrmvsltgsiatgehiishtassi
krthmelggkapvivfddadieavvegvrtfgyynagqdctaacriyaqkgiydtlvekl
gaavatlksgapddestelgplsslahlervgkaveeakatghikvitggekrkgngyyy
aptllagalqddaivqkevfgpvvsvtpfdneeqvvnwandsqyglassvwtkdvgrahr
vsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhvmvkh

SCOPe Domain Coordinates for d1wnbc_:

Click to download the PDB-style file with coordinates for d1wnbc_.
(The format of our PDB-style files is described here.)

Timeline for d1wnbc_: