SCOPe 2.08: Domain d1wmhb_: 1wmh B:

Lineage for d1wmhb_ (1wmh B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (11 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Partitioning defective-6 homolog alpha, PAR-6 alpha [117831] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117832] (1 PDB entry)
   Uniprot Q9NPB6 14-95

8. Domain d1wmhb_: 1wmh B: [114745]
   Other proteins in same PDB: d1wmha_

Details for d1wmhb_

PDB Entry: 1wmh, 1.5 Å

PDB Description: Crystal structure of a PB1 domain complex of Protein kinase c iota and Par6 alpha

PDB Compounds: (B:) Partitioning defective-6 homolog alpha

SCOPe Domain Sequences for d1wmhb_:

Sequence; same for both SEQRES and ATOM records:

>d1wmhb_ d.15.2.2 (B:) Partitioning defective-6 homolog alpha, PAR-6 alpha {Human (Homo sapiens) [TaxId: 9606]}
sivevkskfdaefrrfalprasvsgfqefsrllravhqipgldvllgytdahgdllpltn
ddslhralasgppplrllvqkr

Timeline for d1wmhb_:

• d1wmhb_ first appeared in SCOP 1.71
  
• d1wmhb_ appears in SCOPe 2.07