Lineage for d1wmha_ (1wmh A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179003Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2179019Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2179065Protein Protein kinase C, iota type [110804] (1 species)
  7. 2179066Species Human (Homo sapiens) [TaxId:9606] [110805] (2 PDB entries)
    Uniprot P41743 16-98 ! Uniprot P41743 16-99
  8. 2179067Domain d1wmha_: 1wmh A: [114744]
    Other proteins in same PDB: d1wmhb_

Details for d1wmha_

PDB Entry: 1wmh (more details), 1.5 Å

PDB Description: Crystal structure of a PB1 domain complex of Protein kinase c iota and Par6 alpha
PDB Compounds: (A:) Protein kinase C, iota type

SCOPe Domain Sequences for d1wmha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmha_ d.15.2.2 (A:) Protein kinase C, iota type {Human (Homo sapiens) [TaxId: 9606]}
qvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpctvssql
eleeafrlyelnkdsellihvfp

SCOPe Domain Coordinates for d1wmha_:

Click to download the PDB-style file with coordinates for d1wmha_.
(The format of our PDB-style files is described here.)

Timeline for d1wmha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wmhb_