SCOPe 2.05: Domain d1wmha_: 1wmh A:

Lineage for d1wmha_ (1wmh A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (11 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Protein kinase C, iota type [110804] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110805] (2 PDB entries)
   Uniprot P41743 16-98 ! Uniprot P41743 16-99

8. Domain d1wmha_: 1wmh A: [114744]
   Other proteins in same PDB: d1wmhb_

Details for d1wmha_

PDB Entry: 1wmh, 1.5 Å

PDB Description: Crystal structure of a PB1 domain complex of Protein kinase c iota and Par6 alpha

PDB Compounds: (A:) Protein kinase C, iota type

SCOPe Domain Sequences for d1wmha_:

Sequence; same for both SEQRES and ATOM records:

>d1wmha_ d.15.2.2 (A:) Protein kinase C, iota type {Human (Homo sapiens) [TaxId: 9606]}
qvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpctvssql
eleeafrlyelnkdsellihvfp

Timeline for d1wmha_:

• d1wmha_ first appeared in SCOP 1.71
  
• d1wmha_ appears in SCOPe 2.04
  
• d1wmha_ appears in SCOPe 2.06
  
• d1wmha_ appears in the current release, SCOPe 2.08