Lineage for d1wmge_ (1wmg E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004166Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2004167Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2004168Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2004190Protein Netrin receptor UNC5B [116953] (1 species)
  7. 2004191Species Mouse (Mus musculus) [TaxId:10090] [116954] (1 PDB entry)
    Uniprot Q8K1S3 854-943
  8. 2004196Domain d1wmge_: 1wmg E: [114742]
    complexed with so3, so4

Details for d1wmge_

PDB Entry: 1wmg (more details), 2.1 Å

PDB Description: Crystal structure of the UNC5H2 death domain
PDB Compounds: (E:) netrin receptor Unc5h2

SCOPe Domain Sequences for d1wmge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmge_ a.77.1.2 (E:) Netrin receptor UNC5B {Mouse (Mus musculus) [TaxId: 10090]}
yafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwear
qqddgdlnslasaleemgksemlvamat

SCOPe Domain Coordinates for d1wmge_:

Click to download the PDB-style file with coordinates for d1wmge_.
(The format of our PDB-style files is described here.)

Timeline for d1wmge_: