SCOPe 2.07: Domain d1wmgc_: 1wmg C:

Lineage for d1wmgc_ (1wmg C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
   Pfam PF00531

6. Protein Netrin receptor UNC5B [116953] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [116954] (1 PDB entry)
   Uniprot Q8K1S3 854-943

8. Domain d1wmgc_: 1wmg C: [114740]
   complexed with so3, so4

Details for d1wmgc_

PDB Entry: 1wmg, 2.1 Å

PDB Description: Crystal structure of the UNC5H2 death domain

PDB Compounds: (C:) netrin receptor Unc5h2

SCOPe Domain Sequences for d1wmgc_:

Sequence, based on SEQRES records:

>d1wmgc_ a.77.1.2 (C:) Netrin receptor UNC5B {Mouse (Mus musculus) [TaxId: 10090]}
yafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwear
qqddgdlnslasaleemgksemlvamatd

Sequence, based on observed residues (ATOM records):

>d1wmgc_ a.77.1.2 (C:) Netrin receptor UNC5B {Mouse (Mus musculus) [TaxId: 10090]}
yafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwear
qqdgdlnslasaleemgksemlvamatd

Timeline for d1wmgc_:

• d1wmgc_ first appeared in SCOP 1.71
  
• d1wmgc_ appears in SCOPe 2.06
  
• d1wmgc_ appears in the current release, SCOPe 2.08