Lineage for d1wmga_ (1wmg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2718932Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2718954Protein Netrin receptor UNC5B [116953] (1 species)
  7. 2718955Species Mouse (Mus musculus) [TaxId:10090] [116954] (1 PDB entry)
    Uniprot Q8K1S3 854-943
  8. 2718956Domain d1wmga_: 1wmg A: [114738]
    complexed with so3, so4

Details for d1wmga_

PDB Entry: 1wmg (more details), 2.1 Å

PDB Description: Crystal structure of the UNC5H2 death domain
PDB Compounds: (A:) netrin receptor Unc5h2

SCOPe Domain Sequences for d1wmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmga_ a.77.1.2 (A:) Netrin receptor UNC5B {Mouse (Mus musculus) [TaxId: 10090]}
yafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwear
qqddgdlnslasaleemgksemlvamatdg

SCOPe Domain Coordinates for d1wmga_:

Click to download the PDB-style file with coordinates for d1wmga_.
(The format of our PDB-style files is described here.)

Timeline for d1wmga_: