Lineage for d1wm4a_ (1wm4 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576435Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2576440Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species)
  7. 2576445Species Mouse (Mus musculus) [TaxId:10090] [111106] (2 PDB entries)
    Uniprot Q9CQI6
  8. 2576447Domain d1wm4a_: 1wm4 A: [114737]

Details for d1wm4a_

PDB Entry: 1wm4 (more details)

PDB Description: solution structure of mouse coactosin, an actin filament binding protein
PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1wm4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm4a_ d.109.1.2 (A:) Coactosin-like protein Cotl1 (Clp) {Mouse (Mus musculus) [TaxId: 10090]}
matkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqctddvrlfa
fvrfttgdamskrskfalitwigedvsglqraktgtdktlvkevvqnfakefvisdrkel
eedfirselkkagganydaqse

SCOPe Domain Coordinates for d1wm4a_:

Click to download the PDB-style file with coordinates for d1wm4a_.
(The format of our PDB-style files is described here.)

Timeline for d1wm4a_: