Lineage for d1wm4a_ (1wm4 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609305Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 609306Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 609374Family d.109.1.2: Cofilin-like [55762] (7 proteins)
  6. 609379Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species)
  7. 609384Species Mouse (Mus musculus) [TaxId:10090] [111106] (2 PDB entries)
  8. 609386Domain d1wm4a_: 1wm4 A: [114737]

Details for d1wm4a_

PDB Entry: 1wm4 (more details)

PDB Description: Solution structure of mouse coactosin, an actin filament binding protein

SCOP Domain Sequences for d1wm4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm4a_ d.109.1.2 (A:) Coactosin-like protein Cotl1 (Clp) {Mouse (Mus musculus)}
matkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqctddvrlfa
fvrfttgdamskrskfalitwigedvsglqraktgtdktlvkevvqnfakefvisdrkel
eedfirselkkagganydaqse

SCOP Domain Coordinates for d1wm4a_:

Click to download the PDB-style file with coordinates for d1wm4a_.
(The format of our PDB-style files is described here.)

Timeline for d1wm4a_: