Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) |
Family d.15.1.1: Ubiquitin-related [54237] (26 proteins) Pfam 00240 |
Protein SUMO-2 [117816] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117817] (2 PDB entries) |
Domain d1wm2a_: 1wm2 A: [114735] |
PDB Entry: 1wm2 (more details), 1.6 Å
SCOP Domain Sequences for d1wm2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wm2a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens)} tenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetd tpaqlemededtidvfqq
Timeline for d1wm2a_: