Lineage for d1wlja_ (1wlj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886825Protein Interferon-stimulated gene 20 kDa protein, ISG20 [117652] (1 species)
  7. 2886826Species Human (Homo sapiens) [TaxId:9606] [117653] (1 PDB entry)
    Uniprot Q96AZ6 6-178
  8. 2886827Domain d1wlja_: 1wlj A: [114734]
    complexed with act, mn, u5p

Details for d1wlja_

PDB Entry: 1wlj (more details), 1.9 Å

PDB Description: human ISG20
PDB Compounds: (A:) interferon stimulated gene 20kDa

SCOPe Domain Sequences for d1wlja_:

Sequence, based on SEQRES records: (download)

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]}
evvamdcemvglgphresglarcslvnvhgavlydkfirpegeitdyrtrvsgvtpqhmv
gatpfavarleilqllkgklvvghdlkhdfqalkedmsgytiydtstdrllwreakldhc
rrvslrvlserllhksiqnsllghssvedaratmelyqisqrirarrglprla

Sequence, based on observed residues (ATOM records): (download)

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]}
evvamdcemvglgphresglarcslvnvhgavlydkfirpegeitdyrtrvsgvtpqhmv
gatpfavarleilqllkgklvvghdlkhdfqalkedmsgytiydtstdrllwreaklvsl
rvlserllhksiqnsllghssvedaratmelyqisqrirarrglprla

SCOPe Domain Coordinates for d1wlja_:

Click to download the PDB-style file with coordinates for d1wlja_.
(The format of our PDB-style files is described here.)

Timeline for d1wlja_: