![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Interferon-stimulated gene 20 kDa protein, ISG20 [117652] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117653] (1 PDB entry) Uniprot Q96AZ6 6-178 |
![]() | Domain d1wlja_: 1wlj A: [114734] complexed with act, mn, u5p |
PDB Entry: 1wlj (more details), 1.9 Å
SCOPe Domain Sequences for d1wlja_:
Sequence, based on SEQRES records: (download)
>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} evvamdcemvglgphresglarcslvnvhgavlydkfirpegeitdyrtrvsgvtpqhmv gatpfavarleilqllkgklvvghdlkhdfqalkedmsgytiydtstdrllwreakldhc rrvslrvlserllhksiqnsllghssvedaratmelyqisqrirarrglprla
>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} evvamdcemvglgphresglarcslvnvhgavlydkfirpegeitdyrtrvsgvtpqhmv gatpfavarleilqllkgklvvghdlkhdfqalkedmsgytiydtstdrllwreaklvsl rvlserllhksiqnsllghssvedaratmelyqisqrirarrglprla
Timeline for d1wlja_: