Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (2 proteins) Pfam 00630 |
Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (3 PDB entries) |
Domain d1wlha1: 1wlh A:547-647 [114728] |
PDB Entry: 1wlh (more details), 2.8 Å
SCOP Domain Sequences for d1wlha1:
Sequence, based on SEQRES records: (download)
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum)} paadpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmv dngdgtydvefepkeagdyvinltldgdnvngfpktvtvkp
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum)} paadpeksyaegpgldggecfqpskfkihavdpdgvdggdgfvvtiegpapvdpvmvdng dgtydvefepkeagdyvinltldgdnvngfpktvtvkp
Timeline for d1wlha1: