SCOPe 2.07: Domain d1wlgb_: 1wlg B:

Lineage for d1wlgb_ (1wlg B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.152: Flagellar hook protein flgE [117142] (1 superfamily)
   consists of two different domains; d1: [complex fold made of bifurcated beta-sheets]; d2 (inserted into d1): [beta-sandwich; 8 strands in 2 sheets]

4. Superfamily b.152.1: Flagellar hook protein flgE [117143] (1 family)

5. Family b.152.1.1: Flagellar hook protein flgE [117144] (1 protein)

6. Protein Flagellar hook protein flgE [117145] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [117146] (1 PDB entry)
   Uniprot P16322 71-363

8. Domain d1wlgb_: 1wlg B: [114727]

Details for d1wlgb_

PDB Entry: 1wlg, 1.8 Å

PDB Description: Crystal structure of FlgE31, a major fragment of the hook protein

PDB Compounds: (B:) Flagellar hook protein flgE

SCOPe Domain Sequences for d1wlgb_:

Sequence; same for both SEQRES and ATOM records:

>d1wlgb_ b.152.1.1 (B:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]}
gldvaisqngffrlvdsngsvfysrngqfkldenrnlvnmqgmqltgypatgtpptiqqg
anpapitipntlmaakstttasmqinlnstdpvpsktpfsvsdadsynkkgtvtvydsqg
nahdmnvyfvktkdnewavythdssdpaatapttasttlkfnengilesggtvnittgti
ngataatfslsflnsmqqntgannivatnqngykpgdlvsyqinndgtvvgnysneqeqv
lgqivlanfanneglasqgdnvwaatqasgvallgtagsgnfgkltngaleas

Timeline for d1wlgb_:

• d1wlgb_ first appeared in SCOP 1.71
  
• d1wlgb_ appears in SCOPe 2.06
  
• d1wlgb_ appears in the current release, SCOPe 2.08