![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.152: Flagellar hook protein flgE [117142] (1 superfamily) consists of two different domains; d1: [complex fold made of bifurcated beta-sheets]; d2 (inserted into d1): [beta-sandwich; 8 strands in 2 sheets] |
![]() | Superfamily b.152.1: Flagellar hook protein flgE [117143] (1 family) ![]() |
![]() | Family b.152.1.1: Flagellar hook protein flgE [117144] (1 protein) |
![]() | Protein Flagellar hook protein flgE [117145] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [117146] (1 PDB entry) Uniprot P16322 71-363 |
![]() | Domain d1wlga_: 1wlg A: [114726] |
PDB Entry: 1wlg (more details), 1.8 Å
SCOPe Domain Sequences for d1wlga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella typhimurium [TaxId: 90371]} gldvaisqngffrlvdsngsvfysrngqfkldenrnlvnmqgmqltgypatgtpptiqqg anpapitipntlmaakstttasmqinlnstdpvpsktpfsvsdadsynkkgtvtvydsqg nahdmnvyfvktkdnewavythdssdpaatapttasttlkfnengilesggtvnittgti ngataatfslsflnsmqqntgannivatnqngykpgdlvsyqinndgtvvgnysneqeqv lgqivlanfanneglasqgdnvwaatqasgvallgtagsgnfgkltngaleas
Timeline for d1wlga_: