Lineage for d1wkca_ (1wkc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151198Family c.124.1.6: Methenyltetrahydrofolate synthetase [110520] (3 protein domains)
    Pfam PF01812; 5-FTHF cyclo-ligase
  6. 2151209Protein Hypothetical protein TTHA1611 [117519] (1 species)
  7. 2151210Species Thermus thermophilus [TaxId:274] [117520] (1 PDB entry)
    Uniprot Q5SHW9 1-175
  8. 2151211Domain d1wkca_: 1wkc A: [114724]
    Structural genomics target
    complexed with so4

Details for d1wkca_

PDB Entry: 1wkc (more details), 1.7 Å

PDB Description: Crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from Thermus thermophilus HB8
PDB Compounds: (A:) HB8 TT1367 protein

SCOPe Domain Sequences for d1wkca_:

Sequence, based on SEQRES records: (download)

>d1wkca_ c.124.1.6 (A:) Hypothetical protein TTHA1611 {Thermus thermophilus [TaxId: 274]}
mtkaelrrraraawrrldlkalsravgaallpwlrergfrhillyhplphelnllplmea
yparyylpkvagkgltvhpfgplapgpfgllepttppedprvldlvvvpglafdregyrl
ghgqgfydrflkevraatvgvvpqallfpalprdpwdvpvdhlateagveavkrp

Sequence, based on observed residues (ATOM records): (download)

>d1wkca_ c.124.1.6 (A:) Hypothetical protein TTHA1611 {Thermus thermophilus [TaxId: 274]}
mtkaelrrraraawrrldlkalsravgaallpwlrergfrhillyhplphelnllplmea
yparyylpkvagkgltvhpfgplaepttppedprvldlvvvpglafdregyrlghgqgfy
drflkevraatvgvvpqallfpalprdpwdvpvdhlateagveavkrp

SCOPe Domain Coordinates for d1wkca_:

Click to download the PDB-style file with coordinates for d1wkca_.
(The format of our PDB-style files is described here.)

Timeline for d1wkca_: