Lineage for d1wk4b_ (1wk4 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921513Protein Probable acetyltransferase TTHA1209 [118068] (1 species)
  7. 1921514Species Thermus thermophilus [TaxId:274] [118069] (2 PDB entries)
    Uniprot Q5SJ05
  8. 1921517Domain d1wk4b_: 1wk4 B: [114722]
    Structural genomics target
    complexed with mes

Details for d1wk4b_

PDB Entry: 1wk4 (more details), 2.8 Å

PDB Description: Crystal structure of ttk003001606
PDB Compounds: (B:) ttk003001606

SCOPe Domain Sequences for d1wk4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wk4b_ d.108.1.1 (B:) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]}
vrirragledlpgvarvlvdtwratyrgvvpeafleglsyegqaerwaqrlktptwpgrl
fvaesesgevvgfaafgpdrasgfpgytaelwaiyvlptwqrkglgralfhegarllqae
gygrmlvwvlkenpkgrgfyehlggvllgereielggaklwevaygfdlgghkw

SCOPe Domain Coordinates for d1wk4b_:

Click to download the PDB-style file with coordinates for d1wk4b_.
(The format of our PDB-style files is described here.)

Timeline for d1wk4b_: