Lineage for d1wk1a1 (1wk1 A:8-144)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001437Protein Hypothetical protein F28B4.3 [118166] (1 species)
  7. 3001438Species Nematode (Caenorhabditis elegans) [TaxId:6239] [118167] (1 PDB entry)
    Uniprot Q19853 1193-1329
  8. 3001439Domain d1wk1a1: 1wk1 A:8-144 [114719]
    Other proteins in same PDB: d1wk1a2, d1wk1a3
    Structural genomics target

Details for d1wk1a1

PDB Entry: 1wk1 (more details)

PDB Description: solution structure of lectin c-type domain derived from a hypothetical protein from c. elegans
PDB Compounds: (A:) Hypothetical protein yk1067a12

SCOPe Domain Sequences for d1wk1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wk1a1 d.169.1.1 (A:8-144) Hypothetical protein F28B4.3 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
vkfltvnddilsmpqarnfcasaggyladdlgddknnfyssiaantqfwiglfknsdgqf
ywdrgqginpdllnqpitywangepsndptrqcvyfdgrsgdkskvwttdtcatprpfic
qkhrydsdhkpntigda

SCOPe Domain Coordinates for d1wk1a1:

Click to download the PDB-style file with coordinates for d1wk1a1.
(The format of our PDB-style files is described here.)

Timeline for d1wk1a1: