Lineage for d1wk0a_ (1wk0 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657355Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species)
  7. 657356Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries)
  8. 657357Domain d1wk0a_: 1wk0 A: [114718]
    Structural genomics target

Details for d1wk0a_

PDB Entry: 1wk0 (more details)

PDB Description: Solution structure of Fibronectin type III domain derived from human KIAA0970 protein
PDB Compounds: (A:) KIAA0970 protein

SCOP Domain Sequences for d1wk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgdeetkafeallsnivkpvasdiqartvvltwsppsslingetdessvpelygy
evlisstgkdgkyksvyvgeetnitlndlkpamdyhakvqaeynsikgtpseaeifttls
cepdipnpprisgpssg

SCOP Domain Coordinates for d1wk0a_:

Click to download the PDB-style file with coordinates for d1wk0a_.
(The format of our PDB-style files is described here.)

Timeline for d1wk0a_: