Lineage for d1wk0a_ (1wk0 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550916Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species)
  7. 550917Species Human (Homo sapiens) [TaxId:9606] [117058] (1 PDB entry)
  8. 550918Domain d1wk0a_: 1wk0 A: [114718]
    Structural genomics target

Details for d1wk0a_

PDB Entry: 1wk0 (more details)

PDB Description: Solution structure of Fibronectin type III domain derived from human KIAA0970 protein

SCOP Domain Sequences for d1wk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens)}
gssgssgdeetkafeallsnivkpvasdiqartvvltwsppsslingetdessvpelygy
evlisstgkdgkyksvyvgeetnitlndlkpamdyhakvqaeynsikgtpseaeifttls
cepdipnpprisgpssg

SCOP Domain Coordinates for d1wk0a_:

Click to download the PDB-style file with coordinates for d1wk0a_.
(The format of our PDB-style files is described here.)

Timeline for d1wk0a_: