Lineage for d1wk0a1 (1wk0 A:8-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761872Protein Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) [117057] (1 species)
  7. 2761873Species Human (Homo sapiens) [TaxId:9606] [117058] (6 PDB entries)
    Uniprot Q9Y2H6 192-315
  8. 2761877Domain d1wk0a1: 1wk0 A:8-131 [114718]
    Other proteins in same PDB: d1wk0a2, d1wk0a3
    Structural genomics target

Details for d1wk0a1

PDB Entry: 1wk0 (more details)

PDB Description: solution structure of fibronectin type iii domain derived from human kiaa0970 protein
PDB Compounds: (A:) KIAA0970 protein

SCOPe Domain Sequences for d1wk0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wk0a1 b.1.2.1 (A:8-131) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}
deetkafeallsnivkpvasdiqartvvltwsppsslingetdessvpelygyevlisst
gkdgkyksvyvgeetnitlndlkpamdyhakvqaeynsikgtpseaeifttlscepdipn
ppri

SCOPe Domain Coordinates for d1wk0a1:

Click to download the PDB-style file with coordinates for d1wk0a1.
(The format of our PDB-style files is described here.)

Timeline for d1wk0a1: