![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.111: Small protein B (SmpB) [74981] (2 superfamilies) barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold |
![]() | Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) ![]() |
![]() | Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein) |
![]() | Protein Small protein B (SmpB) [74984] (2 species) tmRNA-binding protein; SsrA-binding protein |
![]() | Species Thermus thermophilus [TaxId:274] [82130] (5 PDB entries) Uniprot Q8RR57 4-123 |
![]() | Domain d1wjxa_: 1wjx A: [114716] Structural genomics target complexed with k |
PDB Entry: 1wjx (more details), 1.7 Å
SCOPe Domain Sequences for d1wjxa_:
Sequence, based on SEQRES records: (download)
>d1wjxa_ b.111.1.1 (A:) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]} vlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapy ekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk
>d1wjxa_ b.111.1.1 (A:) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]} vlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapv dprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk
Timeline for d1wjxa_: