SCOPe 2.08: Domain d1wjxa_: 1wjx A:

Lineage for d1wjxa_ (1wjx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.111: Small protein B (SmpB) [74981] (2 superfamilies)
   barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold

4. Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family)

5. Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)

6. Protein Small protein B (SmpB) [74984] (2 species)
   tmRNA-binding protein; SsrA-binding protein

7. Species Thermus thermophilus [TaxId:274] [82130] (5 PDB entries)
   Uniprot Q8RR57 4-123

8. Domain d1wjxa_: 1wjx A: [114716]
   Structural genomics target
   complexed with k

Details for d1wjxa_

PDB Entry: 1wjx, 1.7 Å

PDB Description: Crystal sturucture of TT0801 from Thermus thermophilus

PDB Compounds: (A:) SsrA-binding protein

SCOPe Domain Sequences for d1wjxa_:

Sequence, based on SEQRES records:

>d1wjxa_ b.111.1.1 (A:) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]}
vlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapy
ekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk

Sequence, based on observed residues (ATOM records):

>d1wjxa_ b.111.1.1 (A:) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]}
vlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapv
dprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk

Timeline for d1wjxa_:

• d1wjxa_ first appeared in SCOP 1.71
  
• d1wjxa_ appears in SCOPe 2.07