![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) ![]() contains a single copy of this fold and an extra beta-strand at the C-terminus |
![]() | Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins) Pfam PF00408 |
![]() | Protein Phosphoacetylglucosamine mutase [118093] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118094] (1 PDB entry) Uniprot Q9CYR6 442-540 |
![]() | Domain d1wjwa1: 1wjw A:8-106 [114715] Other proteins in same PDB: d1wjwa2, d1wjwa3 Structural genomics target |
PDB Entry: 1wjw (more details)
SCOPe Domain Sequences for d1wjwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjwa1 d.129.2.1 (A:8-106) Phosphoacetylglucosamine mutase {Mouse (Mus musculus) [TaxId: 10090]} aiyvdlpnrqlkvkvadrrvisttdaerqavtppglqeaindlvkkytlarafvrpsgte divrvyaeansqesadrlayevsllvfqlaggigerpqp
Timeline for d1wjwa1: