![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.129: TBP-like [55944] (9 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) ![]() contains a single copy of this fold and an extra beta-strand at the C-terminus |
![]() | Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins) Pfam 00408 |
![]() | Protein Phosphoacetylglucosamine mutase [118093] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118094] (1 PDB entry) |
![]() | Domain d1wjwa_: 1wjw A: [114715] Structural genomics target |
PDB Entry: 1wjw (more details)
SCOP Domain Sequences for d1wjwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjwa_ d.129.2.1 (A:) Phosphoacetylglucosamine mutase {Mouse (Mus musculus)} gssgssgaiyvdlpnrqlkvkvadrrvisttdaerqavtppglqeaindlvkkytlaraf vrpsgtedivrvyaeansqesadrlayevsllvfqlaggigerpqpsgpssg
Timeline for d1wjwa_: