Lineage for d1wjwa_ (1wjw A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610723Fold d.129: TBP-like [55944] (9 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 610857Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 610858Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam 00408
  6. 610865Protein Phosphoacetylglucosamine mutase [118093] (1 species)
  7. 610866Species Mouse (Mus musculus) [TaxId:10090] [118094] (1 PDB entry)
  8. 610867Domain d1wjwa_: 1wjw A: [114715]
    Structural genomics target

Details for d1wjwa_

PDB Entry: 1wjw (more details)

PDB Description: solution structure of the c-terminal domain of mouse phosphoacetylglucosamine mutase (pagm)

SCOP Domain Sequences for d1wjwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjwa_ d.129.2.1 (A:) Phosphoacetylglucosamine mutase {Mouse (Mus musculus)}
gssgssgaiyvdlpnrqlkvkvadrrvisttdaerqavtppglqeaindlvkkytlaraf
vrpsgtedivrvyaeansqesadrlayevsllvfqlaggigerpqpsgpssg

SCOP Domain Coordinates for d1wjwa_:

Click to download the PDB-style file with coordinates for d1wjwa_.
(The format of our PDB-style files is described here.)

Timeline for d1wjwa_: