Lineage for d1wjwa1 (1wjw A:8-106)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538955Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2538956Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 2538963Protein Phosphoacetylglucosamine mutase [118093] (1 species)
  7. 2538964Species Mouse (Mus musculus) [TaxId:10090] [118094] (1 PDB entry)
    Uniprot Q9CYR6 442-540
  8. 2538965Domain d1wjwa1: 1wjw A:8-106 [114715]
    Other proteins in same PDB: d1wjwa2, d1wjwa3
    Structural genomics target

Details for d1wjwa1

PDB Entry: 1wjw (more details)

PDB Description: Solution structure of the C-terminal domain of mouse phosphoacetylglucosamine mutase (PAGM)
PDB Compounds: (A:) Phosphoacetylglucosamine mutase

SCOPe Domain Sequences for d1wjwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjwa1 d.129.2.1 (A:8-106) Phosphoacetylglucosamine mutase {Mouse (Mus musculus) [TaxId: 10090]}
aiyvdlpnrqlkvkvadrrvisttdaerqavtppglqeaindlvkkytlarafvrpsgte
divrvyaeansqesadrlayevsllvfqlaggigerpqp

SCOPe Domain Coordinates for d1wjwa1:

Click to download the PDB-style file with coordinates for d1wjwa1.
(The format of our PDB-style files is described here.)

Timeline for d1wjwa1: